Vasoactive Intestinal Peptide (VIP)
Also known as: Aviptadil (related drug)
Vasoactive Intestinal Peptide (VIP), also called Aviptadil (related drug), is an endogenous neuropeptide in the VPAC Receptor Agonist class. Vasoactive intestinal peptide is a 28-amino-acid neuropeptide of the secretin/glucagon superfamily, released from enteric, autonomic and central neurons. It acts at VPAC1 and VPAC2, Gs-coupled receptors whose activation raises cyclic AMP and activates protein kinase A.
For research use only.
Key Facts
- CAS
- 37221-79-7
- Molecular Weight (MW)
- 3325.8 g/mol
- Half-life
- Not established (rapid enzymatic degradation; route dependent)
- FDA status
- Not Approved
- Administration Route
- Subcutaneous, Intramuscular, Intravenous, or Intranasal (investigational contexts)
- Frequency
- Not established
- Last updated
- Aug 30, 2026
- Reviewed
- Aug 30, 2026
- Targets
- VPAC1VPAC2
Vendor price snapshot
Each vendor counts once, at the median price per mg of its own listings; the typical range is the middle half of vendors. From public vendor listings collected between Dec 2025 and Sep 2026, so confirm the live price on the vendor site. Peptide Library does not sell peptides.
- Vendors listing this peptide
- 14
- Listed offers
- 20
- Median price per mg
- $10.00/mg
- Typical $8.50–$13.00/mg
Research summary
28-aa neuropeptide vasodilator and VPAC agonist. Aviptadil (synthetic VIP) has been studied in pulmonary settings but VIP itself is not an FDA-approved general-use drug.
Peptide Library's Vasoactive Intestinal Peptide (VIP) profile summarises 5 cited studies listed in the Science section, the compound's regulatory status, and research-protocol parameters reported for it. It is a research reference, not medical advice.
Protocol
- Dosage Range
- Not established (research only)
- Frequency
- Not established
- Cycle
- Not established (research only; do not self-administer)
- Administration Route
- Subcutaneous, Intramuscular, Intravenous, or Intranasal (investigational contexts)
- Reconstitution Guide
- Reconstitute per lab SOP (commonly bacteriostatic water) and handle cold chain as required
- Injection Sites
- Abdomen (subQ)Glute (IM)
- Concentration Example
- Example only: 5 mg vial reconstituted with 2 mL = 2.5 mg/mL
- Expected Onset
- Acute vasodilatory and bronchodilatory signaling in experimental models
Not yet checked against primary sources
These figures are compiled from earlier reference material. They have not been verified against FDA labelling, registered trials or published literature, no citation is attached to them, and none of them is a recommended dose. Vasoactive Intestinal Peptide (VIP) is queued for dosage evidence review.
Compare reported doses across the whole librarySequence & molecular data
| Amino acid sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
|---|---|
| Molecular formula | C147H237N43O43S |
| Molecular weight | 3325.8 g/mol |
| CAS number | 37221-79-7 |
| Half-life | Not established (rapid enzymatic degradation; route dependent) |
| Appearance | White lyophilized powder |
| Formulation | Lyophilized Powder |
| PubChem CID | 53314964 |
| FDA UNII | 6J2WVD66KR |
Identifiers link to the public PubChem, FDA Substance Registration (UNII), ChEMBL and DrugBank records for the same entity.
Science
Mechanism of Action
Vasoactive intestinal peptide is a 28-amino-acid neuropeptide of the secretin/glucagon superfamily, released from enteric, autonomic and central neurons. It acts at VPAC1 and VPAC2, Gs-coupled receptors whose activation raises cyclic AMP and activates protein kinase A. The resulting effects are broad because the receptors are widely distributed: relaxation of vascular and airway smooth muscle producing vasodilation and bronchodilation, stimulation of intestinal water and electrolyte secretion, and substantial immunomodulation, where VIP shifts macrophage and T-cell responses toward an anti-inflammatory profile. It is also a circadian signalling molecule in the suprachiasmatic nucleus. Its very short plasma half-life is the main obstacle to therapeutic use.
Origin
Endogenous 28-aa peptide.
Targets
Studies
- Anticipated pharmacological role of Aviptadil on COVID-19
- Recent advances in vasoactive intestinal peptide physiology and pathophysiology: focus on the gastrointestinal system
- Identification and characterization of vasoactive intestinal peptide receptor antagonists with high-affinity and potent anti-leukemia activity
- Suprachiasmatic Nucleus Vasoactive Intestinal Peptide Neurons Mediate Light-induced Transient Forgetting
- The role of vasoactive intestinal peptide (VIP) in atropine-related inhibition of the progression of myopia
Regulatory & research status
Vasoactive Intestinal Peptide (VIP) is not an FDA-approved product. It is sold for laboratory research and has no approved medical use.
| FDA status | Not Approved |
|---|---|
| Availability | Research-Only |
| WADA (sport) | Unknown / Not Listed |
| Library classification | Research-Only |
Benefits
Vasoactive Intestinal Peptide (VIP) side effects
Side Effects
- Flushing
- Hypotension
- Diarrhea
Storage & stability
Lyophilized (freeze-dried) peptide powder is far more stable than the reconstituted solution. Keep sealed vials cold, dry and away from light; long-term storage is typically frozen, with short-term refrigeration for vials in use.
Once reconstituted in bacteriostatic water, keep the solution refrigerated, avoid repeated freeze–thaw cycles and agitation, and label the vial with the reconstitution date and concentration. Discard any solution that turns cloudy or shows particulates.
Degradation rates differ by sequence: peptides containing methionine, cysteine, asparagine or glutamine are more prone to oxidation and deamidation, so shelf life after reconstitution is compound-specific rather than universal.
Read the full guide: how to store peptides before and after reconstitution →
Source: Manning MC, Chou DK, Murphy BM, Payne RW, Katayama DS. Stability of protein pharmaceuticals: an update. Pharm Res. 2010;27(4):544–575. (PMID 20143256). General guidance for research handling; not product-specific instructions.
Vasoactive Intestinal Peptide (VIP): frequently asked questions
What is Vasoactive Intestinal Peptide (VIP)?
28-aa neuropeptide vasodilator and VPAC agonist. Aviptadil (synthetic VIP) has been studied in pulmonary settings but VIP itself is not an FDA-approved general-use drug.
How does Vasoactive Intestinal Peptide (VIP) work?
Vasoactive intestinal peptide is a 28-amino-acid neuropeptide of the secretin/glucagon superfamily, released from enteric, autonomic and central neurons. It acts at VPAC1 and VPAC2, Gs-coupled receptors whose activation raises cyclic AMP and activates protein kinase A.
Is Vasoactive Intestinal Peptide (VIP) FDA approved?
No. Vasoactive Intestinal Peptide (VIP) is not approved by the FDA for any indication and is categorised as research-only. It has not been reviewed for safety or efficacy as a medicine, and published research should be read as investigation rather than established use.
What is the half-life of Vasoactive Intestinal Peptide (VIP)?
Reported half-life for Vasoactive Intestinal Peptide (VIP) is Not established (rapid enzymatic degradation; route dependent). Half-life describes how long the compound persists in circulation, not how long any effect lasts, and published figures vary with route of administration, formulation and the population studied.
What is the amino acid sequence of Vasoactive Intestinal Peptide (VIP)?
Vasoactive Intestinal Peptide (VIP) has the sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, giving a chain of 2 amino acids. Its molecular formula is C147H237N43O43S.
What peptides are similar to Vasoactive Intestinal Peptide (VIP)?
Compounds most often compared with Vasoactive Intestinal Peptide (VIP) include Bonomarlot, Bronchogen, Chonluten and Glutathione. They are grouped by shared mechanism or research area rather than by equivalence, and their regulatory status and evidence base differ.
References
- Anticipated pharmacological role of Aviptadil on COVID-19 — Environ Sci Pollut Res Int, 2022External reference
- Recent advances in vasoactive intestinal peptide physiology and pathophysiology: focus on the gastrointestinal system — F1000Res, 2019External reference
- Identification and characterization of vasoactive intestinal peptide receptor antagonists with high-affinity and potent anti-leukemia activity — J Biol Chem, 2026External reference
- Suprachiasmatic Nucleus Vasoactive Intestinal Peptide Neurons Mediate Light-induced Transient Forgetting — Neurosci Bull, 2025External reference
- The role of vasoactive intestinal peptide (VIP) in atropine-related inhibition of the progression of myopia — BMC Ophthalmol, 2024External reference
Related research, comparisons & guides
Related peptides
Compiled by Peptide Library Editorial · Reviewed Aug 30, 2026 · Updated Aug 30, 2026 · Version 1
This Vasoactive Intestinal Peptide (VIP) profile is compiled from published literature (5 cited studies linked above), public regulatory records and chemical registries. It describes what research reports; it is not medical advice, and nothing here is a dosing recommendation for humans. Peptide Library does not sell peptides. Editorial policy · How profiles are compiled · Report an error
Track Vasoactive Intestinal Peptide (VIP) research, inventory and reconstitution in the free Peptide Library app. Get the app for iOS or Android →